In one paragraphArticle in Marine drugs, 2026. The graph could read no effect estimate from its abstract, so it casts no vote on the map. Not yet cited in PubMed.
0numbers the graph read from it
0cells of the map it votes in
0citing papers in PubMed
–field-weighted citation impact
What it found
Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.
The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.
2 · The registryThe trial behind it
Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.
Neither the registry nor the abstract names a trial number. If this is a trial report, that itself is worth knowing.
3 · Its place in the literatureWho cites it
0 citing papers in PubMed.
No citing paper in PubMed yet.
4 · The recordCorrections and comments
PubMed lists nothing against this paper. Absence here is not a guarantee, only a check that was made.
5 · Who and what moneyAuthors and funding
10 authors.
Mariele StaropoliLaboratory for Chiral Technologies, Division of Organic Chemistry and Biochemistry, Ruđer Bošković Institute, Bijenička cesta 54, 10000 Zagreb, Croatia.ORCID 0009-0002-4049-6744 Theresa SchwaigerInstitute of Molecular Bioscience, University of Graz, Humboldstr. 50, 8010 Graz, Austria.
Jasmina TuzlakInstitute of Molecular Bioscience, University of Graz, Humboldstr. 50, 8010 Graz, Austria.
Renata BibaDivision of Molecular Medicine, Ruđer Bošković Institute, Bijenička cesta 54, 10000 Zagreb, Croatia.ORCID 0000-0001-9091-5199 Lukas PetrowitschInstitute of Molecular Bioscience, University of Graz, Humboldstr. 50, 8010 Graz, Austria.ORCID 0009-0001-7304-2231 Johannes FesslerDivision of Immunology, Otto Loewi Research Center, Medical University of Graz, 8036 Graz, Austria.ORCID 0000-0002-8841-3795 Marin RojeLaboratory for Chiral Technologies, Division of Organic Chemistry and Biochemistry, Ruđer Bošković Institute, Bijenička cesta 54, 10000 Zagreb, Croatia.ORCID 0000-0002-7478-1490 Matteo CammarataDepartment of Earth and Marine Sciences, University of Palermo, Viale delle Scienze, Ed. 16, 90128 Palermo, Italy.ORCID 0000-0002-5497-1246 Nermina MalanovićInstitute of Molecular Bioscience, University of Graz, Humboldstr. 50, 8010 Graz, Austria.ORCID 0000-0002-2903-9369 Andreja JakasLaboratory for Chiral Technologies, Division of Organic Chemistry and Biochemistry, Ruđer Bošković Institute, Bijenička cesta 54, 10000 Zagreb, Croatia.ORCID 0000-0001-6095-7515 Funding
Croatian Science Foundation IP-2024-05-1216European Union NextGenerationEU NPOO.C3.2.R3-I1.04.0122FWF grant Grant-DOI 10.55776/P36985
6 · The paper itselfAbstract
Equinin B (GQCQRKCLGHCSKKCPKHPQCRKRCIRRCFGYCL), a marine peptide from
Indexed as
Anti-Bacterial AgentsAntimicrobial Cationic PeptidesGram-Negative BacteriaGram-Positive BacteriaAmino Acid SequenceAnimalsHemolysisHydrophobic and Hydrophilic InteractionsMicrobial Sensitivity TestsStructure-Activity RelationshipAnti-Bacterial AgentsAntimicrobial Cationic PeptidesGram-positive bacteriamarine peptidesmembrane permeabilitypeptide–membrane interactionspeptide specificitysolid phase peptide synthesisstructure-function relationship
Identifiers
PMID41590743
PMCPMC12842892
What OpenQuestion holds
Textmetadata
LicenceCC BY
Read underepoch 390