ArticleZoological research2024
Cath-KP, a novel peptide derived from frog skin, prevents oxidative stress damage in a Parkinson's disease model.
Article in Zoological research, 2024. The graph could read no effect estimate from its abstract, so it casts no vote on the map. Cited by 11 papers.
What it found
Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.
The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.
The trial behind it
Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.
Neither the registry nor the abstract names a trial number. If this is a trial report, that itself is worth knowing.
Who cites it
11 citing papers in PubMed, 24 citations in OpenAlex.
- Peptide RL-QN15 Regulates Functions of Epidermal Stem Cells to Accelerate Skin Wound Regeneration via the FZD8/β-Catenin Axis.Exploration (Beijing, China) · 2026Article
- First identification of an amphibian-derived peptide with anti-vascular aging activity.Zoological research · 2026Article
- Targeting Microglial CD49a Inhibits Neuroinflammation and Demonstrates Therapeutic Potential for Parkinson's Disease.Advanced science (Weinheim, Baden-Wurttemberg, Germany) · 2026Article
- Frog-Derived Peptide RL-RF10 Facilitates Gingival Repair and Regeneration Through the Integrin αvβ3/p38/Snail1 Axis.International dental journal · 2026Article
- Peptides derived from exocrine secretions of venomous animals used as traditional Chinese "worm" medicines.Zoological research · 2026Review
- Cathelicidin-Ka, the first frog-derived TLR2 and TLR4 agonist, induces macrophage activation and promotes inflammation.Cellular and molecular life sciences : CMLS · 2026Article
- Stigmasterol exerts antioxidant effects through activation of the Keap1/Nrf2 signaling pathway in Parkinson's disease model.Journal of translational medicine · 2025Article
- Peptide OM-LV20 demonstrates neuroprotective effects by attenuating mitochondria-mediated neuronal apoptosis and dysfunction in mice with traumatic brain injury.Zoological research · 2025Article
- Temporin-1CEa and its Analog LK2(6)A(L) Confer Neuroprotective Effects in Parkinson's Disease Model by Attenuating Neuroinflammation Via the NF-κB and MAPK Signaling Pathways.Journal of neuroimmune pharmacology : the official journal of the Society on NeuroImmune Pharmacology · 2025Article
- The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases.Antibiotics (Basel, Switzerland) · 2025Review
- Tick-Derived Peptide Blocks Potassium Channel TREK-1.International journal of molecular sciences · 2024Article
Corrections and comments
PubMed lists nothing against this paper. Absence here is not a guarantee, only a check that was made.
Authors and funding
12 authors at 4 institutions in 1 country.
Funding
No grant is acknowledged in the PubMed record.
Abstract
Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing a pivotal role in its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, a novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of the Asiatic painted frog (
Indexed as
Identifiers
What OpenQuestion holds
Registered trials
Read under generation 80e0d062 · epoch 390. Bibliography from PubMed, PubMed Central and OpenAlex; grants from NIH RePORTER; trial links from ClinicalTrials.gov; estimates, votes and beliefs from the OpenQuestion graph.