Evidence map›Paper›PMID 35806154›Full record

ArticleInternational journal of molecular sciences2022

Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site.

Lu Fan, Athanasia Warnecke, Julia Weder, Matthias Preller, Carsten Zeilinger

Abstract read
PubMed Full text at PMC Publisher
In one paragraph

Article in International journal of molecular sciences, 2022. The graph could read no effect estimate from its abstract, so it casts no vote on the map. Cited by 1 paper.

0numbers the graph read from it
0cells of the map it votes in
1citing papers in PubMed
–field-weighted citation impact
1 · What the graph read from it

What it found

Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.

The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.

2 · The registry

The trial behind it

Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.

Neither the registry nor the abstract names a trial number. If this is a trial report, that itself is worth knowing.

3 · Its place in the literature

Who cites it

1 citing paper in PubMed.

  1. Article
4 · The record

Corrections and comments

PubMed lists nothing against this paper. Absence here is not a guarantee, only a check that was made.

5 · Who and what money

Authors and funding

5 authors.

Lu FanBMWZ (Zentrum für Biomolekulare Wirkstoffe), Gottfried-Wilhelm-Leibniz University of Hannover, Schneiderberg 38, 30167 Hannover, Germany.ORCID 0000-0001-9962-5577
Athanasia WarneckeDepartment for Otorhinolaryngology-Head and Neck Surgery, Hannover Medical School (MHH), 30625 Hannover, Germany.
Julia WederInstitute for Biophysical Chemistry, Hannover Medical School, Carl-Neuberg-Straße 1, 30625 Hannover, Germany.
Matthias PrellerInstitute for Biophysical Chemistry, Hannover Medical School, Carl-Neuberg-Straße 1, 30625 Hannover, Germany.ORCID 0000-0002-7784-4012
Carsten ZeilingerBMWZ (Zentrum für Biomolekulare Wirkstoffe), Gottfried-Wilhelm-Leibniz University of Hannover, Schneiderberg 38, 30167 Hannover, Germany.ORCID 0000-0002-6560-0977

Funding

Cluster of Excellence Hearing4All EXC 2177/1Deutsche Forschungsgemeinschaft ZE 338/16-1
6 · The paper itself

Abstract

Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC

Indexed as

Adenosine TriphosphateTriiodothyronineBinding SitesHSP90 Heat-Shock ProteinsMolecular Docking SimulationProtein BindingAdenosine TriphosphateHSP90 Heat-Shock ProteinsTriiodothyronineHsp90molecular dockingprotein microarraythermophoresistriiodothyronine

Identifiers

PMID35806154
PMCPMC9266618

What OpenQuestion holds

Textmetadata
LicenceCC BY
Read underepoch 390

Registered trials

None linked

Read under generation 80e0d062 · epoch 390. Bibliography from PubMed, PubMed Central and OpenAlex; grants from NIH RePORTER; trial links from ClinicalTrials.gov; estimates, votes and beliefs from the OpenQuestion graph.