Evidence map›Paper›PMID 28334609›Full record

ArticleNeuron2017

Basolateral to Central Amygdala Neural Circuits for Appetitive Behaviors.

Joshua Kim, Xiangyu Zhang, Shruti Muralidhar, Sarah A LeBlanc, Susumu Tonegawa

Open access · bronzeAbstract read
PubMed Full text at PMC Publisher
In one paragraph

Article in Neuron, 2017. The graph could read no effect estimate from its abstract, so it casts no vote on the map. Cited by 274 papers.

0numbers the graph read from it
0cells of the map it votes in
274citing papers in PubMed
20.4field-weighted citation impact, top 1% of its field
1 · What the graph read from it

What it found

Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.

The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.

2 · The registry

The trial behind it

Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.

Neither the registry nor the abstract names a trial number. If this is a trial report, that itself is worth knowing.

3 · Its place in the literature

Who cites it

274 citing papers in PubMed, 492 citations in OpenAlex.

  1. Article
  2. Article
  3. Article
  4. Article
  5. Article
  6. Central amygdalar PKCδ neurons mediate fentanyl withdrawal.Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology · 2026
    Article
  7. Article
  8. Article
  9. Neurotensin in the extended amygdala maintains wakefulness in novel environments.Proceedings of the National Academy of Sciences of the United States of America · 2026
    Article
  10. Article
  11. A neural circuit basis for reward-induced suppression of fear generalization and enhancement of fear extinction.Proceedings of the National Academy of Sciences of the United States of America · 2026
    Article
  12. Trigeminal Motor Nucleus Regulates Microstructure of Feeding Behavior without Affecting Total Food Intake.The Journal of neuroscience : the official journal of the Society for Neuroscience · 2025
    Article
  13. Article
  14. Review
  15. Article
  16. Article
  17. Article
  18. Article
  19. Article
  20. Article

214 more citing papers are in PubMed but not listed here.

4 · The record

Corrections and comments

PubMed lists nothing against this paper. Absence here is not a guarantee, only a check that was made.

5 · Who and what money

Authors and funding

5 authors at 2 institutions in 2 countries.

Joshua KimRIKEN-MIT Center for Neural Circuit Genetics at The Picower Institute for Learning and Memory, Department of Biology and Department of Brain and Cognitive Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139, USA. Electronic address: joshuak@mit.edu.
Xiangyu ZhangRIKEN-MIT Center for Neural Circuit Genetics at The Picower Institute for Learning and Memory, Department of Biology and Department of Brain and Cognitive Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139, USA.
Shruti MuralidharRIKEN-MIT Center for Neural Circuit Genetics at The Picower Institute for Learning and Memory, Department of Biology and Department of Brain and Cognitive Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139, USA.
Sarah A LeBlancRIKEN-MIT Center for Neural Circuit Genetics at The Picower Institute for Learning and Memory, Department of Biology and Department of Brain and Cognitive Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139, USA.
Susumu TonegawaRIKEN-MIT Center for Neural Circuit Genetics at The Picower Institute for Learning and Memory, Department of Biology and Department of Brain and Cognitive Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139, USA; Howard Hughes Medical Institute, Massachusetts Institute of Technology, Cambridge, MA 02139, USA; Brain Science Institute, RIKEN, Saitama 351-0198, Japan. Electronic address: tonegawa@mit.edu.
Massachusetts Institute of Technology · USRIKEN Center for Brain Science · JP

Funding

PRE-DOCTORAL TRAINING IN THE BIOLOGICAL SCIENCEST32GM007287 · NIGMS · MASSACHUSETTS INSTITUTE OF TECHNOLOGY · PI BELL, STEPHEN P., KEATING, AMY E · 1985 to 2019
$40.8M
Howard Hughes Medical InstituteNIGMS NIH HHS T32 GM007287
6 · The paper itself

Abstract

Basolateral amygdala (BLA) principal cells are capable of driving and antagonizing behaviors of opposing valence. BLA neurons project to the central amygdala (CeA), which also participates in negative and positive behaviors. However, the CeA has primarily been studied as the site for negative behaviors, and the causal role for CeA circuits underlying appetitive behaviors is poorly understood. Here, we identify several genetically distinct populations of CeA neurons that mediate appetitive behaviors and dissect the BLA-to-CeA circuit for appetitive behaviors. Protein phosphatase 1 regulatory subunit 1B

Indexed as

AnimalsAppetitive BehaviorBasolateral Nuclear ComplexCentral Amygdaloid NucleusMaleMiceMice, TransgenicNeural InhibitionNeural PathwaysNeuronsProtein Phosphatase 1Receptors, Dopamine D1R-SpondinsThrombospondinsDrd1 protein, mouseProtein Phosphatase 1Receptors, Dopamine D1RSPO2 protein, mouseR-SpondinsThrombospondinsamygdala circuitappetitivebasolateral amygdalacentral amygdaladirect and indirect pathwaysdrinkingfearfeedingfreezingreward

Identifiers

PMID28334609
PMCPMC5480398
OpenAlexW2602799162

What OpenQuestion holds

Textmetadata
LicenceTDM
Read underepoch 390

Registered trials

None linked

Read under generation 80e0d062 · epoch 390. Bibliography from PubMed, PubMed Central and OpenAlex; grants from NIH RePORTER; trial links from ClinicalTrials.gov; estimates, votes and beliefs from the OpenQuestion graph.